Overview

  • Product name

    Recombinant Human SelM protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMK HLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQ VPPEYVWAPAKPPEETSDHADL
    • Molecular weight

      14 kDa
    • Amino acids

      24 to 145
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 145. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab225656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Selenoprotein M

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Selenoprotein M
    • Selenoprotein SelM
    • SELM
    • SelM protein
    • SEPM
    see all
  • Relevance

    Selenoprotein M is widely expressed and expressed highly in the mammalian brain. It is localized to the perinuclear structures (Golgi/ER). A growing body of evidence relates selenium to cancer prevention, immune system function, male fertility, cardiovascular disorder, control of the aging and neurodiseases process. Selenoproteins are thought to be responsible for the majority of these biomedical effects of selenium. Approximately 17 selenoproteins have been identified until now. Although the function of many selenoproteins are unknown, some play important roles in antioxidant mechanisms. It has been also implicated in the regulation of signaling pathways through catalysis of thiol/disulfide exchange. The roles of Selenoprotein M have not been clearly identified until present time.
  • Cellular localization

    Cytoplasm; perinuclear region. Endoplasmic reticulum Probable. Golgi apparatus Probable. Note: Localized to perinuclear structures corresponding to Golgi and endoplasmic reticulum.

References

ab225656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up