Recombinant Human SelM protein (ab225656)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human SelM protein -
Purity
> 90 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMK HLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQ VPPEYVWAPAKPPEETSDHADL -
Predicted molecular weight
14 kDa -
Amino acids
24 to 145 -
Additional sequence information
This product is the mature full length protein from aa 24 to 145. The signal peptide is not included.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab225656 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
This product was previously labelled as Selenoprotein M
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituents: 50% Glycerol (glycerin, glycerine), Tris buffer
General Info
-
Alternative names
- Selenoprotein M
- Selenoprotein SelM
- SELM
see all -
Relevance
Selenoprotein M is widely expressed and expressed highly in the mammalian brain. It is localized to the perinuclear structures (Golgi/ER). A growing body of evidence relates selenium to cancer prevention, immune system function, male fertility, cardiovascular disorder, control of the aging and neurodiseases process. Selenoproteins are thought to be responsible for the majority of these biomedical effects of selenium. Approximately 17 selenoproteins have been identified until now. Although the function of many selenoproteins are unknown, some play important roles in antioxidant mechanisms. It has been also implicated in the regulation of signaling pathways through catalysis of thiol/disulfide exchange. The roles of Selenoprotein M have not been clearly identified until present time. -
Cellular localization
Cytoplasm; perinuclear region. Endoplasmic reticulum Probable. Golgi apparatus Probable. Note: Localized to perinuclear structures corresponding to Golgi and endoplasmic reticulum.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab225656 has not yet been referenced specifically in any publications.