Description

  • Product name

    Recombinant Human SEMA3B protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGG GGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATH
    • Predicted molecular weight

      37 kDa
    • Amino acids

      651 to 748

Specifications

Our Abpromise guarantee covers the use of ab152827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ul.

     This product was previously labelled as Semaphorin 3B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • SEM3B_HUMAN
    • Sema A(V)
    • Sema V
    • Sema3b
    • Semaphorin V
    • Semaphorin-3B
    • Semaphorin-V
    see all
  • Function

    Inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
  • Tissue specificity

    Expressed abundantly but differentially in a variety of neural and nonneural tissues.
  • Sequence similarities

    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization

    Secreted. Endoplasmic reticulum. Accumulates in the endoplasmic reticulum.
  • Information by UniProt

Images

  • ab152827 analysis on 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab152827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up