Overview

  • Product name

    Recombinant Human SEMA4C/SEMAI protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LLIQHVMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAH ARWTFGGRDLPAEQPGSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGAR
    • Amino acids

      536 to 635
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SEMA4C

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA1739
    • M-SEMA-F
    • S4c
    • SEM4C_HUMAN
    • Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C
    • SEMA4C
    • SEMACL1
    • SEMAF
    • SEMAI
    • Semaphorin-4C
    • UNQ5855/PRO34487
    see all
  • Function

    Probable signaling receptor which may play a role in myogenic differentiation through activation of the stress-activated MAPK cascade.
  • Sequence similarities

    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane.
  • Information by UniProt

Images

  • ab162889 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up