Recombinant Human SEMA6C protein (ab161027)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLISDLQGTSPLSWFRGL EDDAVAAELGLDFQRFLTLNRTLLVAARDHVFSFDLQAEEEGEGLVPNKY LTWRSQDVENCAVRGKLTDECYNYIRVLVPWDSQTLLACGTNSFSPVCRS YGITSLQQEGEELSGQARCPFDATQSNVAIFAEGSLYSATAADFQASDAV VYRSLGPQPPLRSAKYDSKWLREPHFVQALEHGDHVYFFFREVSVEDARL GRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL QALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDEIERGFEGKFKEQ RSLDGAWTPVSEDRVPSPRPGSCAGVGGAALFSSSRDLPDDVLTFIKAHP LLDPAVPPVTHQPLLTLTSRALLTQVAVDGMAGPHSNITVMFLGSNDGTV LKVLTPGGRSGGPEPILLEEIDAYSPARCSGKRTAQTARRIIGLELDTEG HRLFVAFSGCIVYLPLSRCARHGACQRSCLASQDPYCGWHSSRGCVDIRG SGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYGVRRDLPPASASRS VPIPLLLASVAAAFALGASVSGLLVSCACRRAHRRRGKDIETPGLPRPLS LRSLARLHGGGPEPPPPSKDGDAVQTPQLYTTFLPPPEGVPPPELACLPT PESTPELPVKHLRAAGDPWEWNQNRNNAKEGPGRSRGGHAAGGPAPRVLV RPPPPGCPGQAVEVTTLEELLRYLHGPQPPRKGAEPPAPLTSRALPPEPA PALLGGPSPRPHECASPLRLDVPPEGRCASAPARPALSAPAPRLGVGGGR RLPFSGHRAPPALLTRVPSGGPSRYSGGPGKHLLYLGRPEGYRGRALKRV DVEKPQLSLKPPLVGPSSRQAVPNGGRFNF
    • Amino acids
      1 to 930
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1869
    • m Sema Y
    • m Sema Y2
    • sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6C
    • Sema Y
    • Semaphorin 6C
    • Semaphorin 6C [Precursor]
    • Semaphorin Y
    • SEMAY
    see all
  • Relevance
    SEMA6C belongs to a subfamily characterized by an extracellular semaphorin domain, a transmembrane domain, and a long cytoplasmic tail. Members of this class can repel sympathetic and dorsal root ganglion axons in vitro, consistent with a traditional role as guidance signals. SEMA6C shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro and may be a stop signal for the DRG neurons in their target areas, and possibly also for other neurons. SEMA6C may also be involved in the maintenance and remodeling of neuronal connections.
  • Cellular localization
    Membrane; Single-pass type I membrane protein.

Images

  • ab161027 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up