Recombinant Human SEMA6D protein (ab164191)

Overview

  • Product name
    Recombinant Human SEMA6D protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLQNIDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDIQ MAHQNLMLDPMGSMSEVPPKVPNREASLYSPPSTLPRNS
    • Amino acids
      852 to 940
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • KIAA1479
    • Q8NFY4
    • Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D
    • Semaphorin 6D
  • Relevance
    SEMA6D belongs to the semaphorin family of proteins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. SEMA6D shows growth cone collapsing activity on dorsal root ganglion (DRG) neurons in vitro and may be a stop signal for DRG neurons in their target areas, and possibly also for other neurons. It may also be involved in the maintenance and remodeling of neuronal connections.
  • Cellular localization
    Isoforms 1-6: Cell membrane; Single-pass type I membrane protein. Isoform 7: Cytoplasm.

Images

  • ab164191 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up