Description

  • Product name

    Recombinant Human SEMAC protein
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LSPRISLPLGSEERPFLRFEAEHISNYTALLLSRDGRTLYVGAREALFAL SSNLSFLPGGEYQELLWGADAEKKQQCSFKGKDPQRDCQNYIKILLPLSG SHLFTCGTAAFSPMCTYINMENFTLARDEKGNVLLEDGKGRCPFDPNFKS TALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESSLNWLQDPAFVAS AYIPESLGSLQGDDDKIYFFFSETGQEFEFFENTIVSRIARICKGDEGGE RVLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFTLSPSPQDWRDTLFYGV FTSQWHRGTTEGSAVCVFTMKDVQRVFSGLYKEVNRETQQWYTVTHPVPT PRPGACITNSARERKINSSLQLPDRVLNFLKDHFLMDGQVRSRMLLLQPQ ARYQRVAVHRVPGLHHTYDVLFLGTGDGRLHKAVSVGPRVHIIEELQIFS SGQPVQNLLLDTHRGLLYAASHSGVVQVPMANCSLYRSCGDCLLARDPYC AWSGSSCKHVSLYQPQLATRPWIQDIEGASAKDLCSASSVVSPSFVPTGE KPCEQVQFQPNTVNTLACPLLSNLATRLWLRNGAPVNASASCHVLPTGDL LLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDEGGSVPVII STSRVSAPAGGKASWGADRSYWKEVDDIEGRMDEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      103 kDa including tags
    • Amino acids

      39 to 712
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused with a polyhistidine tag and FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab191921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as SEMA4B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Dissolve protein in 1 x PBS to a concentration no less than 100ug/ml.

General Info

  • Alternative names

    • KIAA1745
    • MGC131831
    • Sema domain immunoglobulin domain (Ig) transmembrane domain (TM) and short cytoplasmic domain (semaphorin) 4B
    • Sema domain immunoglobulin domain (Ig) transmembrane domain (TM) and short cytoplasmic domain 4B
    • SEMA4B
    • SEMAC
    • Semaphorin 4B
    • SemC
    see all
  • Relevance

    SEMA4B belongs to the semaphorin family and contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
  • Cellular localization

    Membrane

References

ab191921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up