Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEM QMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES
    • Amino acids

      653 to 751
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Sema E
    • SEMA3C
    • semaE
    • Semahorin3C
    • Semaphorin E
    • SemaphorinE
    see all
  • Relevance

    The Semaphorins constitute a large family of secreted and membrane-tethered cell signaling molecules. They have functions in neural development, immunology, cardiac growth, vascular development, lung morphogenesis and axial bone patterning. Semaphorins are defined by the presence of a conserved Sema domain at the N-terminus. These proteins can be classified into eight classes depending on their structure and species origin. Classes 3 through 7 are found in vertebrates; class 3 are secreted, class 7 are GPI-anchored and class 4 through 6 are transmembrane proteins. Two distinct transmembrane receptor families have been identified as Semaphorin receptors. Neuropilins provide binding specificity for the class 3 Semaphorins, whereas Plexins, which also contain a Sema domain serve as signaling partners for class 3 Semaphorins and as functional receptors for transmembrane Semaphorins. Semaphorin 3c inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. It is expressed maximally between days E10-12 with moderate levels from day E13 until birth.
  • Cellular localization

    Secreted

Images

  • ab161031 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up