Description

  • Product name

    Recombinant Human Semaphorin 4D/CD100 protein
    See all Semaphorin 4D/CD100 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAVF AVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSAT SLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDG ELYSGTSYNFLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSP DSPDGEDDRVYFFFTEVSVEYEFVFRVLIPRIARVCKGDQGGLRTLQKKW TSFLKARLICSRPDSGLVFNVLRDVFVLRSPGLKVPVFYALFTPQLNNVG LSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNGPVPKPRPGACI DSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNYT QIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFE PVQTLLLSSKKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCA WSPPTATCVALHQTESPSRGLIQEMSGDASVCPDKSKGSYRQHFFKHGGT AELKCSQKSNLARVFWKFQNDVLKAESPKYGLMGRKNLLIFNLSEGDSGV YQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSVVQTEGSRIATK VLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQLH SEKTMYLKSSDNRVDHHHHHH
    • Predicted molecular weight

      80 kDa including tags
    • Amino acids

      22 to 734
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab192291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Semaphorin 4D

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Reconstitute for long term storage.

  • Reconstitution
    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.

General Info

  • Alternative names

    • A8
    • BB 18
    • BB18
    • CD 100
    • CD100
    • CD100 antigen
    • Coll 4
    • COLL4
    • Collapsin 4
    • Collapsin4
    • GR3
    • Leukocyte activation antigen CD100
    • M sema G
    • MSEMA
    • SEM4D_HUMAN
    • Sema 4d
    • Sema domain immunoglobulin domain Ig transmembrane domain TM and short cytoplasmic domain semaphorin 4D
    • Sema H
    • SEMA J
    • Sema4d
    • Semacl 2
    • Semacl2
    • SemaH
    • SEMAJ
    • Semaphorin 4D
    • Semaphorin C like 2
    • Semaphorin H
    • Semaphorin J
    • Semaphorin-4D
    • Semaphorin4D
    • SemaphorinJ
    • Semcl 2
    • Semcl2
    see all
  • Function

    May play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
  • Tissue specificity

    Strongly expressed in skeletal muscle, peripheral blood lymphocytes, spleen, and thymus and also expressed at lower levels in testes, brain, kidney, small intestine, prostate, heart, placenta, lung and pancreas, but not in colon and liver.
  • Sequence similarities

    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab192291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up