Recombinant Human Semaphorin 7a protein (ab160048)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQ SCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED
    • Amino acids
      536 to 633
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 108
    • CD108
    • CD108 antigen
    • CDw108
    • H Sema K1
    • H Sema L
    • H-SEMA-K1
    • H-Sema-L
    • JMH
    • JMH blood group antigen
    • John Milton Hagen blood group H Sema K1
    • John Milton Hargen human blood group Ag
    • John-Milton-Hargen human blood group Ag
    • MGC126692
    • MGC126696
    • SEM7A_HUMAN
    • Sema domain immunoglobulin domain (Ig) and GPI membrane anchor 7A
    • Sema K1
    • Sema L
    • SEMA7A
    • SEMAK1
    • SEMAL
    • Semaphorin 7A GPI membrane anchor
    • Semaphorin K1
    • Semaphorin L
    • Semaphorin-7A
    • Semaphorin-K1
    • Semaphorin-L
    • Semaphorin7a
    see all
  • Function
    Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.
  • Tissue specificity
    Detected in skin keratinocytes and on endothelial cells from skin blood vessels (at protein level). Expressed in fibroblasts, keratinocytes, melanocytes, placenta, testis, ovary, spleen, brain, spinal chord, lung, heart, adrenal gland, lymph nodes, thymus, intestine and kidney.
  • Sequence similarities
    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization
    Cell membrane. Detected in a punctate pattern on the cell membrane of basal and supra-basal skin keratinocytes.
  • Information by UniProt

Images

  • ab160048 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up