Recombinant Human Semaphorin 7a protein (Fc Chimera His Tag) (ab227401)

Description

  • Product name

    Recombinant Human Semaphorin 7a protein (Fc Chimera His Tag)
    See all Semaphorin 7a proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab227401 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPQGHLRSGPRIFAVWKGHVGQDRVDFGQTEPHTVLFHEPGSSSVWVGG RGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLL ACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTI RKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIY YFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVC SDAATNKNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGD IDKVFRTSSLKGYHSSLPNPRPGKCLPDQQPIPTETFQVADRHPEVAQRV EPMGPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYLTTDRGTIHKVVE PGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPLD LCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKEC PNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGH QSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLL GHACALALEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      96 kDa including tags
    • Amino acids

      45 to 648
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 45 to 648 fused to hIgG-His-tag at the C-terminus . The signal peptide and propeptide are not included (NP_003603).

Specifications

Our Abpromise guarantee covers the use of ab227401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • CD 108
    • CD108
    • CD108 antigen
    • CDw108
    • H Sema K1
    • H Sema L
    • H-SEMA-K1
    • H-Sema-L
    • JMH
    • JMH blood group antigen
    • John Milton Hagen blood group H Sema K1
    • John Milton Hargen human blood group Ag
    • John-Milton-Hargen human blood group Ag
    • MGC126692
    • MGC126696
    • SEM7A_HUMAN
    • Sema domain immunoglobulin domain (Ig) and GPI membrane anchor 7A
    • Sema K1
    • Sema L
    • SEMA7A
    • SEMAK1
    • SEMAL
    • Semaphorin 7A GPI membrane anchor
    • Semaphorin K1
    • Semaphorin L
    • Semaphorin-7A
    • Semaphorin-K1
    • Semaphorin-L
    • Semaphorin7a
    see all
  • Function

    Plays an important role in integrin-mediated signaling and functions both in regulating cell migration and immune responses. Promotes formation of focal adhesion complexes, activation of the protein kinase PTK2/FAK1 and subsequent phosphorylation of MAPK1 and MAPK3. Promotes production of proinflammatory cytokines by monocytes and macrophages. Plays an important role in modulating inflammation and T-cell-mediated immune responses. Promotes axon growth in the embryonic olfactory bulb. Promotes attachment, spreading and dendrite outgrowth in melanocytes.
  • Tissue specificity

    Detected in skin keratinocytes and on endothelial cells from skin blood vessels (at protein level). Expressed in fibroblasts, keratinocytes, melanocytes, placenta, testis, ovary, spleen, brain, spinal chord, lung, heart, adrenal gland, lymph nodes, thymus, intestine and kidney.
  • Sequence similarities

    Belongs to the semaphorin family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 PSI domain.
    Contains 1 Sema domain.
  • Cellular localization

    Cell membrane. Detected in a punctate pattern on the cell membrane of basal and supra-basal skin keratinocytes.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227401.

    MW: 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab227401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up