Recombinant Human SEMCAP3 protein (ab161507)

Overview

  • Product name
    Recombinant Human SEMCAP3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEG SCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCGRVVKLQQLPE HLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPL THGEQRAGGHCCARALRAHNGALQARLGALHKALKKEALRAGKREKSLVA QLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTL VLHRDSGSLGFNIIGGRPSVDNHDGSSSEGIFVSKIVDSGPAAKEGGLQI HDRIIEVNGRDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPPSE SQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPYLLPEEHPSAHEYYDPN DYIGDIHQEMDREELELEEVDLYRMNSQDKLGLTVCYRTDDEDDIGIYIS EIDPNSIAAKDGRIREGDRIIQINGIEVQNREEAVALLTSEENKNFSLLI ARPELQLDEGWMDDDRNDFLDDLHMDMLEEQHHQAMQFTASVLQQKKHDE DGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSNPL AGQRKLTCSQDTLGSGDLPFSNESFISADCTDADYLGIPVDECERFRELL ELKCQVKSATPYGLYYPSGPLDAGKSDPESVDKELELLNEELRSIELECL SIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDVRRHELSDITELPEKS DKDSSSAYNTGESCRSTPLTLEISPDNSLRRAAEGISCPSSEGAVGTTEA YGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPT PSQKLGSAYLPSYHHSPYKHAHIPAHAQHYQSYMQLIQQKSAVEYAQSQM SLVSMCKDLSSPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRERALKI REERSGMTTDDDAVSEMKMGRYWSKEERKQHLVKAKEQRRRREFMMQSRL DCLKEQQAADDRKEMNILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKS PDGTRVYNSFLSVTTV
    • Amino acids
      1 to 1066
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E3 ubiquitin-protein ligase PDZRN3
    • KIAA1095
    • Ligand of Numb protein X 3
    • likely ortholog of mouse semaF cytoplasmic domain associated protein 3
    • LNX3
    • PDZ domain containing ring finger 3
    • PDZ domain-containing RING finger protein 3
    • Pdzrn3
    • Protein SEMACAP3
    • PZRN3_HUMAN
    • SEMACAP3
    • Semaphorin cytoplasmic domain associated protein
    • Semaphorin cytoplasmic domain-associated protein 3
    • SEMCAP3
    see all
  • Function
    E3 ubiquitin-protein ligase. Plays an important role in regulating the surface level of MUSK on myotubes. Mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. Might contribute to terminal myogenic differentiation.
  • Tissue specificity
    Widely expressed, including in the heart, skeletal muscle and liver and, at lower levels, in the brain, colon, small intestine, placenta and lung. Down-regulated in ovarian serous papillary tumors.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 2 PDZ (DHR) domains.
    Contains 1 RING-type zinc finger.
    Contains 1 TRAF-type zinc finger.
  • Domain
    The RING-type zinc finger domain is required for E3 ligase activity.
  • Post-translational
    modifications
    Auto-ubiquitinated.
  • Information by UniProt

Images

  • ab161507 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up