Description

  • Product name

    Recombinant Human SENP2 protein
  • Purity

    > 95 % SDS-PAGE.
    Determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 0.100 Eu/ng
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGHHHHHHGSLQDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIK KTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIE AHREQIGGDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQT LKNYHWLNDEVINFYMNLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAV KRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRI CEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCK YADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      363 to 589
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab199592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 5% Glycerol, 1.19% HEPES

General Info

  • Alternative names

    • Axam2
    • DKFZp762A2316
    • KIAA1331
    • Senp2
    • SENP2_HUMAN
    • Sentrin specific protease 2
    • Sentrin-specific protease 2
    • Sentrin/SUMO specific protease SENP2
    • Sentrin/SUMO-specific protease SENP2
    • SMT3 specific isopeptidase 2
    • SMT3-specific isopeptidase 2
    • Smt3ip2
    • SUMO1/sentrin/SMT3 specific peptidase 2
    see all
  • Function

    Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. May down-regulate CTNNB1 levels and thereby modulate the Wnt pathway.
  • Sequence similarities

    Belongs to the peptidase C48 family.
  • Domain

    The N-terminus is necessary and sufficient for nuclear envelope targeting.
  • Post-translational
    modifications

    Polyubiquitinated; which leads to proteasomal degradation.
  • Cellular localization

    Nucleus > nuclear pore complex. Nucleus membrane. Cytoplasm. Shuttles between cytoplasm and nucleus.
  • Information by UniProt

References

ab199592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up