Overview

  • Product name

    Recombinant Human SENP5 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTW NRQLRHFQGRKKALQIQKTWIKDEHLCAKTKFNVATQNVSTLSSKVKRKD AKHFISSSKTLLRLQAEKLLSSAKNSDHEYCREKNLLKAVTDFPSNSALG QANGHRPRTDPQPSDFPMKFNGESQSPGESGTIVVTLNNHKRKGFCYGCC QGPEHHRNGGPLIPKKFQLNQHRRIKLSPLMMYEKLSMIRFRYRILRSQH FRTKSKVCKLRKAQRSWVQKVTGDHQETRRENGEGGSCSPFPSPEPKDPS CRHQPYFPDMDSSAVVKGTNSHVPDCHTKGSSFLGKELSLDEAFPDQQNG SATNAWDQSSCSSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQE NQTSSVSDDRVKLSVSGADTSVSSVDGPVSQKAVQNENSYQMEEDGSLKQ SILSSELLDHPYCKSPLEAPLVCSGLKLENQVGGGKNSQKASPVDDEQLS VCLSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITN YRARHQKCNFRIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVP DKVHFFNSFFHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSLI TVTLSNRIISFYDSQGIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAV TKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCE CRLMD
    • Amino acids

      1 to 755
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FKSG45
    • FLJ42398
    • MGC27076
    • Protease FKSG45
    • SENP5
    • SENP5_HUMAN
    • Sentrin specific protease SENP5
    • Sentrin-specific protease 5
    • Sentrin/SUMO specific protease SENP5
    • Sentrin/SUMO-specific protease SENP5
    • SUMO specific protease SENP5
    • SUMO1/sentrin specific peptidase 5
    • SUMO1/sentrin specific protease 5
    see all
  • Function

    Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO3 to its mature form and deconjugation of SUMO2 and SUMO3 from targeted proteins. Has weak proteolytic activity against full-length SUMO1 or SUMO1 conjugates. Required for cell division.
  • Sequence similarities

    Belongs to the peptidase C48 family.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab165909 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up