Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDH VSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGG THWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFV EEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRG EWKDLITTLAKK
    • Molecular weight

      24 kDa
    • Amino acids

      1 to 212
    • Additional sequence information

      NM_001166340.1

Specifications

Our Abpromise guarantee covers the use of ab206009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.32% Tris, 0.87% Sodium chloride, 0.15% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • cysteine 2
    • DEN 1
    • DEN1
    • Deneddylase 1
    • Deneddylase-1
    • FKSG8
    • HsT17512
    • NEDD 8 specific protease 1
    • NEDD8 specific protease cysteine 2
    • NEDD8-specific protease 1
    • NEDP 1
    • NEDP1
    • Protease
    • Protease, cysteine 2
    • PRSC2
    • SENP8
    • SENP8_HUMAN
    • Sentrin / SUMO specific protease SENP 8
    • Sentrin-specific protease 8
    • Sentrin/SUMO-specific protease SENP8
    • SUMO sentrin specific protease family member 8
    • SUMO/sentrin peptidase family member, NEDD8 specific
    • SUMO/sentrin specific peptidase family member 8
    see all
  • Function

    Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.
  • Tissue specificity

    Broadly expressed, with highest levels in kidney and pancreas.
  • Sequence similarities

    Belongs to the peptidase C48 family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab206009 (5µg), Coomassie-stained.

References

ab206009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up