Overview

  • Product name

    Recombinant Human Separase protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      REELQAYKAVRADTGQERFNIICDLLELSPEETPAGAWARATHLVELAQV LCYHDFTQQTNCSALDAIREALQLLDSVRPEAQARDQLLDDKAQALLWLY ICTLEAKIQEGIERDR
    • Amino acids

      586 to 701
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Caspase like protein ESPL1
    • Caspase-like protein ESPL1
    • ESP 1
    • ESP1
    • ESPL 1
    • Espl1
    • ESPL1_HUMAN
    • Extra spindle poles like 1
    • Extra spindle poles like 1 protein
    • Extra spindle poles-like 1 protein
    • FLJ46492
    • KIAA0165
    • Separase
    • Separin
    • Similar to fission yeast cut1and gene
    • SSE
    see all
  • Function

    Caspase-like protease, which plays a central role in the chromosome segregation by cleaving the SCC1/RAD21 subunit of the cohesin complex at the onset of anaphase. During most of the cell cycle, it is inactivated by different mechanisms.
  • Sequence similarities

    Belongs to the peptidase C50 family.
  • Post-translational
    modifications

    Autocleaves. This function, which is not essential for its protease activity, is unknown.
    Phosphorylated by CDK1. There are 8 Ser/Thr phosphorylation sites. Among them, Ser-1126 phosphorylation is the major site, which conducts to the enzyme inactivation.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab153009 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up