Recombinant Human SEPP1 protein (His tag) (ab235969)

Overview

  • Product name

    Recombinant Human SEPP1 protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKL EDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEEN QTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCE KKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLG SSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDL QDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQ CKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRS KNQAKKSESPSN
    • Molecular weight

      45 kDa including tags
    • Amino acids

      20 to 381
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 20 to 381. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab235969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Selenoprotein P
    • Selenoprotein P plasma 1
    • Selp
    • SeP
    • Sepp1
    • SEPP1_HUMAN
    see all
  • Function

    Might be responsible for some of the extracellular antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis.
  • Tissue specificity

    Made in the liver and heart and secreted into the plasma. It is also found in the kidney.
  • Sequence similarities

    Belongs to the selenoprotein P family.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235969.

References

ab235969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up