Overview

  • Product name

    Recombinant Human SEPT4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDRSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKFVKDFSGNASCHPP EAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDNQQYFCAPAPLS PSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVA GESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGV RLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQD NRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVD HKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSN TVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTR ETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETE KLIREKDEELRRMQEMLHKIQKQMKENY
    • Molecular weight

      82 kDa including tags
    • Amino acids

      1 to 478

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Apoptosis-related protein in the TGF-beta signaling pathway
    • ARTS
    • Bradeion
    • Bradeion beta
    • Brain protein H5
    • CE5B3
    • CE5B3 beta
    • Cell division control-related protein 2
    • Cerebral protein 7
    • H5
    • hCDCREL-2
    • hucep-7
    • MART
    • Peanut-like protein 2
    • PNUTL2
    • SEP 4
    • SEP4
    • Sept4
    • SEPT4_HUMAN
    • Septin M
    • Septin-4
    see all
  • Function

    Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). May play a role in platelet secretion. Isoform ARTS, but not the other isoforms, is required for the induction of cell death mediated by TGF-beta and by other apoptotic stimuli.
  • Tissue specificity

    Widely expressed in adult and fetal tissues with highest expression in adult brain (at protein level), heart, liver and adrenal gland and fetal heart, kidney, liver and lung. Also expressed in colorectal cancers and malignant melanomas. Expressed in platelets.
  • Sequence similarities

    Belongs to the septin family.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. In platelets, found in areas surrounding alpha-granules and Mitochondrion. Nucleus. While predominantly localized in the mitochondria under resting conditions, isoform ARTS translocates into the nucleus after TGF-beta treatment and apoptosis induction.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131801 stained with Coomassie Blue.

References

ab131801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up