Description

  • Product name

    Recombinant Human Septin 3 protein
  • Purity

    > 95 % SDS-PAGE.
    ab202152 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSKGLPETRTDAAMSELVPEPRPKPAV PMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTL VNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTP GFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYF ISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKE LEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRV LGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAK RLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 358
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_663786.

Specifications

Our Abpromise guarantee covers the use of ab202152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, 0.02% DTT, 89% PBS

General Info

  • Alternative names

    • bK250D10.3
    • MGC133218
    • Neuronal specific septin 3
    • Neuronal-specific septin-3
    • OTTHUMP00000028742
    • SEP 3
    • SEP3
    • SEPT 3
    • sept3
    • SEPT3 protein
    • SEPT3_HUMAN
    • Septin3
    see all
  • Function

    Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis.
  • Tissue specificity

    Brain-specific.
  • Sequence similarities

    Belongs to the septin family.
  • Post-translational
    modifications

    Phosphorylated by PKG on serine residues. Phosphorylated by PKG on Ser-91.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cell junction > synapse.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202152 (3 µg).

References

ab202152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up