Overview

  • Product name

    Recombinant Human SERBP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPG AKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVVDKKEETQPPVA LKKEGIRRVGRRPDQQLQGEGKIIDRRPERRPPRERRFEKPLEEKGEGGE FSVDRPIIDRPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSD RSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNYSDLDQSNVTE ETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDRAKVEF NIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLE INFGDLGRPGRGGRGGRGGCGRGGRPNRGSRTDKSSASAPDVDDPEAFPA LA
    • Amino acids

      1 to 402
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153267 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CGI 55
    • CHD3IP
    • Chromodomain helicase DNA binding protein 3 interacting protein
    • DKFZp564M2423
    • FLJ90489
    • HABP4L
    • PAI 1 mRNA binding protein
    • PAI RBP1
    • PAI-RBP1
    • PAI1 RNA-binding protein 1
    • PAIRB_HUMAN
    • PAIRBP1
    • Plasminogen activator inhibitor 1 RNA binding protein
    • Plasminogen activator inhibitor 1 RNA-binding protein
    • Serbp1
    • SERPINE1 mRNA binding protein 1
    • SERPINE1 mRNA-binding protein 1
    see all
  • Function

    May play a role in the regulation of mRNA stability. Binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.
  • Tissue specificity

    Expressed at high level in the heart, skeletal muscle and kidney, and at low levels in placenta, liver and brain.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasm > perinuclear region. Also found in perinuclear regions.
  • Information by UniProt

Images

  • ab153267 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153267 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153267.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up