Description

  • Product name

    Recombinant Human SERCA1 ATPase protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPP KREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      522 to 612

Specifications

Our Abpromise guarantee covers the use of ab152208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AT2A1_HUMAN
    • ATP2A
    • ATP2A1
    • ATPase Ca++ transporting cardiac muscle fast twitch 1
    • ATPase Ca++ transporting fast twitch 1
    • ATPase, Ca(2+)-transporting fast twitch 1
    • Calcium pump 1
    • Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform
    • Calcium-transporting ATPase sarcoplasmic reticulum type
    • EC 3.6.3.8
    • Endoplasmic reticulum class 1/2 Ca(2+) ATPase
    • Fast skeletal muscle SR calcium ATPase
    • fast twitch skeletal muscle isoform
    • OTTHUMP00000162561
    • OTTHUMP00000162562
    • Sarcoendoplasmic reticulum calcium ATPase
    • Sarcoplasmic reticulum Ca(2+)-ATPase 1
    • Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
    • SERCA 1
    • SERCA1
    • SERCA1 truncated isoform, included
    • SR Ca(2+) ATPase 1
    • SR Ca(2+)-ATPase 1
    see all
  • Function

    Key regulator of striated muscle performance by acting as the major Ca(2+) ATPase responsible for the reuptake of cytosolic Ca(2+) into the sarcoplasmic reticulum. Catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.
  • Tissue specificity

    Skeletal muscle, fast twitch muscle (type II) fibers.
  • Involvement in disease

    Brody myopathy
  • Sequence similarities

    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.
  • Developmental stage

    Isoform SERCA1A accounts for more than 99% of SERCA1 isoforms expressed in adult skeletal muscle, while isoform SERCA1B predominates in neo-natal skeletal muscle.
  • Cellular localization

    Endoplasmic reticulum membrane. Sarcoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152208 stained with Coomassie Blue.

References

ab152208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up