Overview

  • Product name

    Recombinant Human SERF2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMTRGNQRELARQKNMKKQSDSVKGKRR DDGLSAAARKQRDSEIMQQKQKKANEKKEEPK
    • Molecular weight

      9 kDa including tags
    • Amino acids

      1 to 59
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab171476 was purified using conventional chromatography techniques
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • 4F5rel
    • FAM2C
    • Gastric cancer-related protein VRG107
    • h4F5rel
    • HsT17089
    • Protein 4F5-related
    • Serf2
    • SERF2_HUMAN
    • Small EDRK-rich factor 2
    see all
  • Sequence similarities

    Belongs to the SERF family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab171476.

References

ab171476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up