Description

  • Product name

    Recombinant Human Serine racemase protein
  • Purity

    > 85 % SDS-PAGE.
    ab116196 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMCAQYCISFADVEKAHINIRDSIHLT PVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKP KAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIV YCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPL VDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKL MPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWE RMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWV KQAERPASYQSVSV
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 340
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names

    • D serine ammonia lyase
    • D serine dehydratase
    • D-serine ammonia-lyase
    • D-serine dehydratase
    • ILV1
    • ISO1
    • L serine ammonia lyase
    • L serine dehydratase
    • L-serine ammonia-lyase
    • L-serine dehydratase
    • Serine racemase
    • srr
    • SRR_HUMAN
    see all
  • Function

    Catalyzes the synthesis of D-serine from L-serine. D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine.
  • Tissue specificity

    Brain: expressed at high levels in hippocampus and corpus callosum, intermediate levels in substantia nigra and caudate, and low levels in amygdala, thalamus, and subthalamic nuclei. Expressed in heart, skeletal muscle, kidney and liver.
  • Sequence similarities

    Belongs to the serine/threonine dehydratase family.
  • Post-translational
    modifications

    S-nitrosylated, leading to decrease the enzyme activity.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116196.

References

ab116196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us. Activity has not been assayed. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up