Overview

  • Product name

    Recombinant Human Serotonin transporter protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAV PSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG NVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISI WRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSC KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGG ISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASY NKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKD AGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAV LDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPA VLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLL FIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT PGTFKERIIKSITPETPTEIPCGDIRLNAV
    • Molecular weight

      97 kDa including tags
    • Amino acids

      1 to 630

Specifications

Our Abpromise guarantee covers the use of ab132415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5 HTT
    • 5 HTTLPR
    • 5 hydroxytryptamine (serotonin) transporter
    • 5 hydroxytryptamine transporter
    • 5HT transporter
    • 5HTT
    • hSERT
    • HTT
    • Na+/Cl- dependent serotonin transporter
    • OCD1
    • SC6A4_HUMAN
    • Serotonin transporter 1
    • SERT
    • SERT1
    • Slc6a4
    • Sodium dependent serotonin transporter
    • Sodium-dependent serotonin transporter
    • Solute carrier family 6 (neurotransmitter transporter) member 4
    • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
    • Solute carrier family 6 member 4
    see all
  • Function

    Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
  • Tissue specificity

    Expressed in platelets (at protein level).
  • Sequence similarities

    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily.
  • Post-translational
    modifications

    Glycosylated; modification with sialylated N-glycans is a requirement for transporters to associate with each other and to function as homooligomeric forms.
    Phosphorylated at Ser-611, Thr-613 and Thr-616.
  • Cellular localization

    Cell membrane. Endomembrane system. Endosome membrane. Translocates from intracellular locations to the plasma membrane. Density of transporter molecules on the plasma membrane is itself regulated by serotonin.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132415, stained with Coomassie Blue.

References

ab132415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.


The QC method for ab114363 and ab132415 is CBR staining. When testing the lab loaded 5uL for quantification.


I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up