Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEE FYTRHVLQIHRSKGLQDLGGIS
    • Amino acids
      181 to 252
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159522 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5 HTT
    • 5 HTTLPR
    • 5 hydroxytryptamine (serotonin) transporter
    • 5 hydroxytryptamine transporter
    • 5HT transporter
    • 5HTT
    • hSERT
    • HTT
    • Na+/Cl- dependent serotonin transporter
    • OCD1
    • SC6A4_HUMAN
    • Serotonin transporter 1
    • SERT
    • SERT1
    • Slc6a4
    • Sodium dependent serotonin transporter
    • Sodium-dependent serotonin transporter
    • Solute carrier family 6 (neurotransmitter transporter) member 4
    • solute carrier family 6 (neurotransmitter transporter, serotonin), member 4
    • Solute carrier family 6 member 4
    see all
  • Function
    Serotonin transporter whose primary function in the central nervous system involves the regulation of serotonergic signaling via transport of serotonin molecules from the synaptic cleft back into the pre-synaptic terminal for re-utilization. Plays a key role in mediating regulation of the availability of serotonin to other receptors of serotonergic systems. Terminates the action of serotonin and recycles it in a sodium-dependent manner.
  • Tissue specificity
    Expressed in platelets (at protein level).
  • Sequence similarities
    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily.
  • Post-translational
    modifications
    Glycosylated; modification with sialylated N-glycans is a requirement for transporters to associate with each other and to function as homooligomeric forms.
    Phosphorylated at Ser-611, Thr-613 and Thr-616.
  • Cellular localization
    Cell membrane. Endomembrane system. Endosome membrane. Translocates from intracellular locations to the plasma membrane. Density of transporter molecules on the plasma membrane is itself regulated by serotonin.
  • Information by UniProt

Images

  • ab159522 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159522 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159522.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up