Description

  • Product name

    Recombinant Human Serpin A5 protein
    See all Serpin A5 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab152068 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HRHHPREMKKRVEDLHVGATVAPSSRRDFTFDLYRALASAAPSQNIFFSP VSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQQLLQELN QPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAM KQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQ EQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFIL PSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLP SLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTI FTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRPVDHHHHHH
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      20 to 406
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Protein C inhibitor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 5.50
    Constituents: 0.39% MES, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
    Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Acrosomal serine protease inhibitor
    • IPSP
    • IPSP_HUMAN
    • PAI 3
    • PAI-3
    • PAI3
    • PCI
    • PCI-B
    • PLANH 3
    • PLANH3
    • Plasma serine protease inhibitor
    • Plasminogen activator inhibitor 3
    • Plasminogen activator inhibitor III
    • PROCI
    • Protein C inhibitor
    • Serpin A5
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 5
    • Serpin peptidase inhibitor clade A member 5
    • Serpina5
    see all
  • Function

    Inhibits activated protein C as well as plasminogen activators.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab152068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up