Description

  • Product name

    Recombinant Human SerpinB3/SCCA protein
  • Purity

    > 90 % SDS-PAGE.
    ab202159 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMNSLSEANTKFMFDLFQQFRKSKENNI FYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDR SGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFY QTSESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLNA IYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQA KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETR VDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVL HKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTN SILFYGRFSSP
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 390
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_008850.

Specifications

Our Abpromise guarantee covers the use of ab202159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Protein previously labeled as SerpinB3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • HsT1196
    • Protein T4 A
    • Protein T4-A
    • SCC
    • SCCA
    • SCCA PD
    • SCCA-1
    • SCCA-PD
    • SCCA1
    • SCCAPD
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 3
    • Serpin B3
    • Serpin peptidase inhibitor clade B (ovalbumin) member 3
    • serpin peptidase inhibitor, clade B (ovalbumin), member 3
    • SERPINB3
    • SPB3_HUMAN
    • Squamous cell carcinoma antigen 1
    • T4 A
    • T4-A
    • T4A
    see all
  • Function

    May act as a protease inhibitor to modulate the host immune response against tumor cells.
  • Tissue specificity

    Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Developmental stage

    Its expression is closely related to cellular differentiation in both normal and malignant squamous cells.
  • Cellular localization

    Cytoplasm. Seems to also be secreted in plasma by cancerous cells but at a low level.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202159 (3µg).

References

ab202159 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up