Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTA AQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGTQYLLRVANRLFGEKSC DFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELL SPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMM FKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTY EKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA DFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFC ADHPFLFFIQHSKTNGILFCGRFSSP
    • Molecular weight

      67 kDa including tags
    • Amino acids

      1 to 376

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Product previously known as Recombinant Human SerpinB6/CAP protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAP
    • Cytoplasmic antiproteinase
    • Peptidase inhibitor 6
    • PI-6
    • PI6
    • Placental thrombin inhibitor
    • Protease inhibitor 6 (placental thrombin inhibitor)
    • PTI
    • Serpin B6
    • SERPINB6
    • SPB6_HUMAN
    see all
  • Function

    May be involved in the regulation of serine proteinases present in the brain or extravasated from the blood (By similarity). Inhibitor of cathepsin G, kallikrein-8 and thrombin. May play an important role in the inner ear in the protection against leakage of lysosomal content during stress and loss of this protection results in cell death and sensorineural hearing loss.
  • Tissue specificity

    Expressed in keratinocytes (at protein level). Highest levels in skeletal muscle. Also found in placenta, cardiac muscle, lung, liver, kidney and pancreas. Expressed in the inner ear hair cells. Expressed abundantly by normal mast cells in different tissues and by mast cells in mastocytoma lesions.
  • Involvement in disease

    Defects in SERPINB6 are the cause of deafness autosomal recessive type 91 (DFNB91) [MIM:613453]. It is a form of non-syndromic deafness characterized by progressive and age-dependent sensorineural hearing loss. Vestibular function is normal.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132516 stained with Coomassie Blue.

References

ab132516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up