Description

  • Product name

    Recombinant Human SerpinB7 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LELRYNGGINMYVLLPENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFF PQFKIEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSY I
    • Amino acids

      227 to 327
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Megsin
    • Mesangium predominant gene megsin
    • MGC120014
    • MGC120015
    • Serpin B7
    • Serpin peptidase inhibitor clade B (ovalbumin) member 7
    • Serpinb7
    • SPB7_HUMAN
    • TP55
    see all
  • Function

    Might function as an inhibitor of Lys-specific proteases. Might influence the maturation of megakaryocytes via its action as a serpin.
  • Tissue specificity

    Predominantly expressed in mesangial cells.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab160155 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up