Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASE IEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSP D
    • Amino acids
      72 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SERPINE2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GDN
    • GDN_HUMAN
    • GDNPF
    • Glia derived nexin
    • Glia-derived nexin
    • Glial derived neurite promoting factor
    • P17
    • Peptidase inhibitor 7
    • Pi-7
    • Plasminogen activator inhibitor type 1, member 2
    • PN-1
    • PN1
    • PNI
    • Protease inhibitor 7
    • Protease nexin 1
    • Protease nexin I
    • Serpin E2
    • Serpin family E member 2
    • Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2
    • SERPINE 2
    • Serpine2
    see all
  • Function
    Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin.
  • Sequence similarities
    Belongs to the serpin family.
  • Cellular localization
    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab159116 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up