Description

  • Product name

    Recombinant Human SERPINE2/PN-1 protein
    See all SERPINE2/PN-1 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDN IVISPHGIASVLGMLQLGADGRTKKQLAMVMRYGVNGVGKILKKINKAIV SKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASAC DSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPE NTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGES ISMLIALPTESSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVA QTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKIEVSED GTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP
    • Amino acids

      1 to 398
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     

    The Molecular Weight of this protein (including tags) is 70.4 kDa.

    Previously labelled as SERPINE2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • GDN
    • GDN_HUMAN
    • GDNPF
    • Glia derived nexin
    • Glia-derived nexin
    • Glial derived neurite promoting factor
    • P17
    • Peptidase inhibitor 7
    • Pi-7
    • Plasminogen activator inhibitor type 1, member 2
    • PN-1
    • PN1
    • PNI
    • Protease inhibitor 7
    • Protease nexin 1
    • Protease nexin I
    • Serpin E2
    • Serpin family E member 2
    • Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2
    • SERPINE 2
    • Serpine2
    see all
  • Function

    Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • ab159115 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up