Description

  • Product name

    Recombinant human SERPINE2/PN-1 protein
    See all SERPINE2/PN-1 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca - RPKPVE - Nval - WRK(Dnp) - NH2.

  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGA DGRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNA SEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLL SPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPM LAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTESSTPLSAII PHISTKTIDSWMSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDS SKANFAKITRSENLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPW FIVDRPFLFFIRHNPTGAVLFMGQINKP
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      20 to 397
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 20 to 397. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab200492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as SERPINE2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.50
    Constituents: 0.58% Sodium chloride, 5% Trehalose, 0.16% Sodium acetate

    Lyophilised from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • GDN
    • GDN_HUMAN
    • GDNPF
    • Glia derived nexin
    • Glia-derived nexin
    • Glial derived neurite promoting factor
    • P17
    • Peptidase inhibitor 7
    • Pi-7
    • Plasminogen activator inhibitor type 1, member 2
    • PN-1
    • PN1
    • PNI
    • Protease inhibitor 7
    • Protease nexin 1
    • Protease nexin I
    • Serpin E2
    • Serpin family E member 2
    • Serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2
    • SERPINE 2
    • Serpine2
    see all
  • Function

    Serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Promotes neurite extension by inhibiting thrombin. Binds heparin.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab200492 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 45-48 kDa in SDS-PAGE due to glycosylation.

References

ab200492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up