Description

  • Product name

    Recombinant Human SESN1 protein
  • Purity

    > 44 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AEGENEVRWDGLCSRDSTTRETALENIRQTILRKTEYLRSVKETPHRPSD GLSNTESSDGLNKLLAHLLMLSKRCPFKDVREKSEFILKSIQELGIRIPR PLGQGPSRFIPEKEILQVGSEDAQMHALFADSFAALGRLDNITLVMVFHP QYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVNDFL HVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEH SWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSNYC ICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEA SQEEMASRFEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRH GMHVPTFRVQDYCWEDHGYSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAM HKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVC TPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAELLYALRAITRYMT
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      2 to 551
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      (NM_014454).

Specifications

Our Abpromise guarantee covers the use of ab196424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 10% Glycerol

    Contains 90 µg/ml DDDDK peptide.

General Info

  • Alternative names

    • 1110002G11Rik
    • AU044290
    • MGC118148
    • MGC138241
    • MGC142129
    • OTTMUSP00000022799
    • p53 activated gene 26
    • p53 regulated PA26 nuclear protein
    • p53 regulated protein PA26
    • p53-regulated protein PA26
    • PA26
    • RP11-787I22.1
    • sesn1
    • SESN1_HUMAN
    • SEST1
    • sestrin 1
    • Sestrin-1
    see all
  • Function

    Involved in the reduction of peroxiredoxins. May also be regulator of cellular growth.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the sestrin family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 4 µg ab196424 with Coomassie staining.

References

ab196424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up