Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MIVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPV EEVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLL LHTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLH RAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVL LTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSG GFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPS ADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYS LIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCV FGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHS EKVHVNLLLLEARMQAALLYALRAITRYMT
    • Amino acids

      1 to 480
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SESN2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp761M0212
    • DKFZp761M02121
    • Hi95
    • Hypoxia induced gene 95
    • MGC11758
    • OTTHUMP00000003641
    • OTTMUSP00000010184
    • RP23 63D8.3
    • SES2
    • SESN 2
    • SESN2
    • SESN2_HUMAN
    • SEST2
    • Sestrin 2
    • Sestrin-2
    see all
  • Information by UniProt

Images

  • ab153542 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up