Description

  • Product name

    Recombinant Human SESN2/Sestrin-2 protein
  • Purity

    > 35 % SDS-PAGE.
    ab196408 is greater or than 35% pure as assessed by SDS-PAGE.
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      IVADSECRAELKDYLRFAPGGVGDSGPGEEQRESRARRGPRGPSAFIPVE EVLREGAESLEQHLGLEALMSSGRVDNLAVVMGLHPDYFTSFWRLHYLLL HTDGPLASSWRHYIAIMAAARHQCSYLVGSHMAEFLQTGGDPEWLLGLHR APEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLL THCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGG FESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSA DILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSL IQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVF GIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSE KVHVNLLLLEARMQAALLYALRAITRYMT
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      2 to 480
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      NM_031459.

Specifications

Our Abpromise guarantee covers the use of ab196408 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling

     This product was previously labelled as SESN2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 10% Glycerol

    Contains 90ng DDDDK peptide

General Info

  • Alternative names

    • DKFZp761M0212
    • DKFZp761M02121
    • Hi95
    • Hypoxia induced gene 95
    • MGC11758
    • OTTHUMP00000003641
    • OTTMUSP00000010184
    • RP23 63D8.3
    • SES2
    • SESN 2
    • SESN2
    • SESN2_HUMAN
    • SEST2
    • Sestrin 2
    • Sestrin-2
    see all
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab196408 at 3 µg stained with Coomassie Blue (lane 1). Lane 2 contains a protein marker.

References

ab196408 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196408.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up