Description

  • Product name

    Recombinant Human SET7 protein (Tagged)
    See all SET7 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      YKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKF IDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSCISTNALLPD PYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSRD WALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFV HPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKA FQATQQK
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      110 to 366
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab239446 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • FLJ21193
    • H3 K4 HMTase
    • H3-K4-HMTase SETD7
    • H4 lysine 4 specific
    • Histone H3 K4 methyltransferase
    • Histone H3 lysine 4 specific methyltransferase
    • Histone H3-K4 methyltransferase SETD7
    • Histone H4 K4 methyltransferase
    • Histone lysine N methyltransferase
    • Histone lysine N methyltransferase H3 lysine 4 specific SET7
    • Histone-lysine N-methyltransferase SETD7
    • KIAA1717
    • KMT7
    • Lysine methyltransferase
    • Lysine N-methyltransferase 7
    • OTTHUMP00000164543
    • OTTHUMP00000220049
    • SET 7
    • SET 7/9
    • SET 9
    • SET D7
    • SET domain containing (lysine methyltransferase) 7
    • SET domain containing protein 7
    • SET domain containing protein 8
    • SET domain-containing protein 7
    • SET7
    • SET7/9
    • SET9
    • Setd7
    • SETD7_HUMAN
    see all
  • Function

    Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation. Also able to demethylated 'Lys-372' of p53/TP53 in vitro.
  • Tissue specificity

    Widely expressed. Expressed in pancreatic islets.
  • Sequence similarities

    Belongs to the histone-lysine methyltransferase family. SET7 subfamily.
    Contains 3 MORN repeats.
    Contains 1 SET domain.
  • Domain

    The SET domain is necessary but not sufficient for histone methyltransferase activity.
  • Cellular localization

    Nucleus. Chromosome.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab239446.

References

ab239446 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239446.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up