Overview

  • Product name

    Recombinant Human SETD3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEY VQIRTLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVN FKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQ AMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQST QAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSS VMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA
    • Molecular weight

      60 kDa including tags
    • Amino acids

      1 to 296

Specifications

Our Abpromise guarantee covers the use of ab132885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C14orf154
    • Chromosome 14 open reading frame 154
    • DKFZp761E1415
    • FLJ23027
    • Histone lysine N methyltransferase setd3
    • Histone-lysine N-methyltransferase setd3
    • MGC87236
    • SET domain containing 3
    • SET domain containing protein 3
    • SET domain-containing protein 3
    • SETD 3
    • Setd3
    • SETD3_HUMAN
    see all
  • Function

    Histone methyltransferase that methylates 'Lys-36' of histone H3 (H3K36me). H3 'Lys-36' methylation represents a specific tag for epigenetic transcriptional activation.
  • Sequence similarities

    Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. SETD3 subfamily.
    Contains 1 SET domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132885 stained with Coomassie Blue.

References

ab132885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up