Description

  • Product name

    Recombinant Human Sex Hormone Binding Globulin/SHBG protein
    See all Sex Hormone Binding Globulin/SHBG proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTN PKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDS
    • Amino acids

      41 to 140
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Sex Hormone Binding Globulin. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABP
    • Androgen binding protein
    • SBP
    • Sex hormone-binding globulin
    • Sex steroid binding protein
    • Sex steroid-binding protein
    • SHBG
    • SHBG_HUMAN
    • TeBG
    • Testis specific androgen binding protein
    • Testis-specific androgen-binding protein
    • Testosterone binding beta globulin
    • Testosterone estradiol binding globulin
    • Testosterone estrogen binding globulin
    • Testosterone-estradiol-binding globulin
    • Testosterone-estrogen-binding globulin
    see all
  • Function

    Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.
  • Tissue specificity

    Isoform 1 and isoform 2 are present in liver and testis.
  • Sequence similarities

    Contains 2 laminin G-like domains.
  • Cellular localization

    Secreted. In testis, it is synthesized by the Sertoli cells, secreted into the lumen of the seminiferous tubule and transported to the epididymis.
  • Information by UniProt

Images

  • ab159505 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up