Overview

  • Product name

    Recombinant Human SF3a66 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      IGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEP PDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFH FKMEK
    • Amino acids

      112 to 216
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • pre-mRNA splicing factor SF3A, subunit 2
    • PRP11
    • PRPF11
    • SAP 62
    • SAP62
    • Sf3a2
    • SF3A2_HUMAN
    • SF3a66
    • spliceosome associated protein 62
    • Spliceosome-associated protein 62
    • Splicing factor 3A subunit 2
    • splicing factor 3a, subunit 2, 66kDa
    see all
  • Function

    Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex.
  • Sequence similarities

    Belongs to the SF3A2 family.
    Contains 1 matrin-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab159954 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up