Description

  • Product name

    Recombinant Human SF3B3 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRV MNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPR SVAGGFVYTYK
    • Amino acids

      819 to 929
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KIAA0017
    • Pre mRNA splicing factor SF3b 130 kDa subunit
    • Pre-mRNA-splicing factor SF3b 130 kDa subunit
    • RSE1
    • SAP 130
    • SAP130
    • SF3b130
    • SF3B3
    • SF3B3_HUMAN
    • Spliceosome associated protein 130
    • Spliceosome-associated protein 130
    • Splicing factor 3B subunit 3
    • Splicing factor 3b subunit 3 130kD
    • STAF130
    see all
  • Function

    Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron.
  • Sequence similarities

    Belongs to the RSE1 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153230 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up