Description

  • Product name

    Recombinant Human SF3B4 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVT GQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGA NIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFA SFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP LSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPP GALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGG MPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMG MPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGP LPPPRPTPRPPVPPRGPLRGPLPQ
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      1 to 424

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132083 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AFD1
    • Hsh49
    • MGC10828
    • Pre mRNA splicing factor SF3b 49 kDa subunit
    • Pre-mRNA-splicing factor SF3b 49 kDa subunit
    • SAP 49
    • SAP49
    • Sf3b4
    • SF3B4_HUMAN
    • SF3b49
    • SF3b50
    • Spliceosomal protein
    • Spliceosome associated protein (U2 snRNP)
    • Spliceosome associated protein 49
    • Spliceosome-associated protein 49
    • Splicing factor 3B subunit 4
    • Splicing factor 3b subunit 4 49kDa
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132083, stained with Coomassie Blue.

References

ab132083 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132083.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up