Description

  • Product name

    Recombinant Human SFRP4 protein (His tag)
    See all SFRP4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab219447 was purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELV DVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMY NHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERP LDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVT TVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRM MLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPK PKGKPPAPKPASPKKNIKTRSAQKRTNPKRVHHHHHH
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      19 to 346
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This is the mature protein without the signal peptide. The predicted N terminal is Ala (NP_003005).

Specifications

Our Abpromise guarantee covers the use of ab219447 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • Frizzled protein
    • Frizzled protein human endometrium
    • FRP 4
    • FRP4
    • FrpHE
    • human endometrium
    • PYL
    • Secreted frizzled-related protein 4
    • sFRP-4
    • Sfrp4
    • SFRP4_HUMAN
    see all
  • Function

    Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP4 may act as a regulator of adult uterine morphology and function. Increases apoptosis during ovulation possibly through modulation of FZ1/FZ4/WNT4 signaling (By similarity). Has phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake.
  • Tissue specificity

    Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, expression levels are inversely correlated with expression of CTNNB1 (at protein level).
  • Sequence similarities

    Belongs to the secreted frizzled-related protein (sFRP) family.
    Contains 1 FZ (frizzled) domain.
    Contains 1 NTR domain.
  • Domain

    The FZ domain is involved in binding with Wnt ligands.
  • Cellular localization

    Secreted. Cytoplasmic in ovarian tumor cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219447 (3µg).   

References

ab219447 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219447.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up