Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ERLKGMVQNHQFSTLRISKSTMDFIRFEGEVENKSLVKSFLACLDGKTIK LSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLE GLPC
    • Amino acids

      53 to 156
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 721P
    • A-kinase anchor protein 17A
    • AK17A_HUMAN
    • AKAP-17A
    • AKAP17A
    • arginine/serine-rich 17A
    • B lymphocyte antigen
    • B lymphocyte surface antigen
    • B-lymphocyte antigen
    • CCDC133
    • PRKA17A
    • Protein kinase A-anchoring protein 17A
    • Protein XE7
    • Pseudoautosomal gene XE7
    • SFRS 17A
    • Splicing factor
    • Splicing factor arginine/serine rich 17A
    • XE 7
    • XE7
    see all
  • Function

    Splice factor regulating alternative splice site selection for certain mRNA precursors. Mediates regulation of pre-mRNA splicing in a PKA-dependent manner.
  • Tissue specificity

    Widely expressed. Found in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. Expressed in activated B-cells and placenta. Expressed in all cell lines tested including Jurkat TAg, U937 and HEK293 cells.
  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Domain

    RI-alpha binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.
  • Cellular localization

    Nucleus speckle.
  • Information by UniProt

Images

  • ab159973 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up