Overview

  • Product name

    Recombinant Human SGCE/ESG protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MQLPRWWELGDPCAWTGQGRGTRRMSPATTGTFLLTVYSIFSKVHSDRNV YPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPITFNTNLMGYPDRPGW LRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAYNRRTFETARHNLIINI MSAEDFPLPYQAEFFIKNMNVEEMLASEVLGDFLGAVKNVWQPERLNAIN ITSALDRGGRVPLPINDLKEGVYVMVGADVPFSSCLREVENPQNQLRCSQ EMEPVITCDKKFRTQFYIDWCKISLVDKTKQVSTYQEVIRGEGILPDGGE YKPPSDSLKSRDYYTDFLITLAVPSAVALVLFLILAYIMCCRREGVEKRN MQTPDIQLVHHSAIQKSTKELRDMSKNREIAWPLSTLPVFHPVTGEIIPP LHTDNYDSTNMPLMQTQQNLPHQTQIPQQQTTGKWYP
    • Amino acids

      1 to 437
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SGCE

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • dystonia 11, myoclonic
    • DYT11
    • Epsilon sarcoglycan
    • Epsilon SG
    • Epsilon-sarcoglycan
    • Epsilon-SG
    • ESG
    • sarcoglycan, epsilon
    • sgcE
    • SGCE_HUMAN
    see all
  • Function

    Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in SGCE are a cause of dystonia type 11 (DYT11) [MIM:159900]; also known as myoclonic dystonia or alcohol-responsive dystonia. DYT11 is a myoclonic dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT11 is characterized by involuntary lightning jerks and dystonic movements and postures alleviated by alcohol. Inheritance is autosomal dominant. The age of onset, pattern of body involvement, presence of myoclonus and response to alcohol are all variable.
  • Sequence similarities

    Belongs to the sarcoglycan alpha/epsilon family.
  • Cellular localization

    Cell membrane > sarcolemma. Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab160261 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up