Recombinant Human SGLT2 protein (ab114508)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, SDS-PAGE, WB
Description
-
Product name
Recombinant Human SGLT2 protein
See all SGLT2 proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP -
Predicted molecular weight
31 kDa including tags -
Amino acids
228 to 277
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab114508 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
Western blot
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Low affinity sodium glucose cotransporter
- Low affinity sodium-glucose cotransporter
- Na(+) glucose cotransporter 2
see all -
Function
Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.
Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules. -
Involvement in disease
Defects in SLC5A2 are the cause of renal glucosuria (GLYS1) [MIM:233100]. GLYS1 is an autosomal recessive disorder characterized by a normal fasting serum glucose concentration and persistent isolated glucosuria, with a normal glucose tolerance test. -
Sequence similarities
Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. -
Cellular localization
Membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab114508 has not yet been referenced specifically in any publications.