Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRG TVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEW NALFVVLLLGWLFAPVYLTAGVITMPQYLRKRFGGRRIRLYLSVLSLFLY IFTKISVDMFSGAVFIQQALGWNIYASVIALLGITMIYTVTGGLAALMYT DTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSLTVSEDPAVGN ISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEV CRRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNS SSTLFTMDIYTRLRPRAGDRELLLVGRLWVVFIVVVSVAWLPVVQAAQGG QLFDYIQAVSSYLAPPVSAVFVLALFVPRVNEQGAFWGLIGGLLMGLARL IPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLLTLTVSLCTAP IPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWA RVVNLNALLMMAVAVFLWGFYA
    • Molecular weight

      99 kDa including tags
    • Amino acids

      1 to 672

Specifications

Our Abpromise guarantee covers the use of ab132436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Low affinity sodium glucose cotransporter
    • Low affinity sodium-glucose cotransporter
    • Na(+) glucose cotransporter 2
    • Na(+)/glucose cotransporter 2
    • OTTHUMP00000163298
    • SC5A2_HUMAN
    • SGLT 2
    • SLC5A 2
    • SLC5A2
    • Sodium glucose cotransporter 2
    • Sodium/glucose cotransporter 2
    • Solute carrier family 5 (sodium glucose cotransporter) member 2
    • Solute carrier family 5 (sodium/glucose transporter), member 2
    • Solute carrier family 5 member 2
    see all
  • Function

    Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.
    Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
  • Involvement in disease

    Defects in SLC5A2 are the cause of renal glucosuria (GLYS1) [MIM:233100]. GLYS1 is an autosomal recessive disorder characterized by a normal fasting serum glucose concentration and persistent isolated glucosuria, with a normal glucose tolerance test.
  • Sequence similarities

    Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132436 stained with Coomassie Blue.

References

ab132436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up