Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRG TVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEW NA
    • Molecular weight

      16 kDa including tags
    • Amino acids

      1 to 102
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236175 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Low affinity sodium glucose cotransporter
    • Low affinity sodium-glucose cotransporter
    • Na(+) glucose cotransporter 2
    • Na(+)/glucose cotransporter 2
    • OTTHUMP00000163298
    • SC5A2_HUMAN
    • SGLT 2
    • SLC5A 2
    • SLC5A2
    • Sodium glucose cotransporter 2
    • Sodium/glucose cotransporter 2
    • Solute carrier family 5 (sodium glucose cotransporter) member 2
    • Solute carrier family 5 (sodium/glucose transporter), member 2
    • Solute carrier family 5 member 2
    see all
  • Function

    Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.
    Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
  • Involvement in disease

    Defects in SLC5A2 are the cause of renal glucosuria (GLYS1) [MIM:233100]. GLYS1 is an autosomal recessive disorder characterized by a normal fasting serum glucose concentration and persistent isolated glucosuria, with a normal glucose tolerance test.
  • Sequence similarities

    Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel using ab236175.

References

ab236175 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236175.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up