Description

  • Product name

    Recombinant Human SGPL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWT LLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDIS KNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVY SGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGP DSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAAS YFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPE VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISAD THKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGI SAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSV IALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQF LKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLY STDTVTQGSQMNGSPKPH
    • Amino acids

      1 to 568
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ13811
    • hSPL
    • KIAA1252
    • S1P
    • S1PL
    • SGPL 1
    • SGPL1
    • SGPL1_HUMAN
    • SP lyase
    • SP-lyase 1
    • Sphingosine 1 phosphate aldolase
    • Sphingosine 1 phosphate lyase 1
    • Sphingosine-1-phosphate aldolase
    • Sphingosine-1-phosphate lyase 1
    • SPL
    • SPL 1
    see all
  • Function

    Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis.
  • Tissue specificity

    Found in liver and kidney.
  • Pathway

    Lipid metabolism; sphingolipid metabolism.
  • Sequence similarities

    Belongs to the group II decarboxylase family. Sphingosine-1-phosphate lyase subfamily.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab160241 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up