Recombinant Human SH2D1A/SAP protein - BSA and Azide free (ab173077)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human SH2D1A/SAP protein - BSA and Azide free
See all SH2D1A/SAP proteins and peptides -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Carrier free
Yes -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYL LRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP -
Predicted molecular weight
16 kDa including tags -
Amino acids
1 to 128 -
Tags
His tag N-Terminus
-
-
Description
Recombinant Human SH2D1A/SAP protein (BSA and azide free)
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab173077 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.50
Constituents: 0.24% Tris, 0.88% Sodium chloride, 10% Glycerol (glycerin, glycerine)
Supplied as a 0.2 µM filtered solution.
General Info
-
Alternative names
- DSHP
- Duncan disease SH2 protein
- Duncan disease SH2-protein
see all -
Function
Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. Mediates interaction between FYN and SLAMF1. May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3. -
Tissue specificity
Expressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Expressed in peripheral blood leukocytes, including T lymphocytes. Tends to be expressed at lower levels in peripheral blood leukocytes in patients with rheumatoid arthritis. -
Involvement in disease
Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma. -
Sequence similarities
Contains 1 SH2 domain. -
Cellular localization
Cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab173077 has not yet been referenced specifically in any publications.