Recombinant Human SH2D1A/SAP protein (BSA and azide free) (ab173077)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human SH2D1A/SAP protein (BSA and azide free)
See all SH2D1A/SAP proteins and peptides -
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceEscherichia coli
-
Amino Acid Sequence
-
Accession
-
SpeciesHuman
-
SequenceMGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYL LRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI KNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
-
Molecular weight16 kDa including tags
-
Amino acids1 to 128
-
TagsHis tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab173077 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Endotoxin level< 1.000 Eu/µg
-
Purity>95% by SDS-PAGE .
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
FormLiquid
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.50
Constituents: 0.24% Tris, 0.88% Sodium chloride, 10% Glycerol
Supplied as a 0.2 µM filtered solution.
General Info
-
Alternative names
- DSHP
- Duncan disease SH2 protein
- Duncan disease SH2-protein
see all -
FunctionInhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the SLAM cytoplasmic region. Mediates interaction between FYN and SLAMF1. May also regulate the activity of the neurotrophin receptors NTRK1, NTRK2 and NTRK3.
-
Tissue specificityExpressed at a high level in thymus and lung, with a lower level of expression in spleen and liver. Expressed in peripheral blood leukocytes, including T lymphocytes. Tends to be expressed at lower levels in peripheral blood leukocytes in patients with rheumatoid arthritis.
-
Involvement in diseaseDefects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma.
-
Sequence similaritiesContains 1 SH2 domain.
-
Cellular localizationCytoplasm.
- Information by UniProt
Datasheets and documents
References
ab173077 has not yet been referenced specifically in any publications.