Description

  • Product name

    Recombinant Human SH2D1B protein (His tag)
  • Purity

    > 90 % SDS-PAGE.
    ab226887 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPMDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFK NIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHL LKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLPHHHHHH
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      1 to 132
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_444512).

Specifications

Our Abpromise guarantee covers the use of ab226887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 20% Glycerol, PBS

General Info

  • Alternative names

    • EAT 2
    • EAT2
    • EWS/FLI1 activated transcript 2
    • SH2 domain containing 1B
    • SH2 domain containing molecule EAT2
    • SH2 domain containing protein 1B
    see all
  • Relevance

    SH2D1B binds phosphotyrosines through its free SRC homology-2 domain. It regulates signal transduction through receptors expressed on the surface of antigen-presenting cells.

Images

  • 15% SDS-PAGE analysis of 3 µg ab226887.

    MW: 18-28 kDa (SDS-PAGE under reducing conditions).

References

ab226887 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up